Klotho KP1 (5MG) Analytical Reference Material (In Vitro Research Only)
Klotho KP1 is a 30-amino-acid peptide matching a stretch of the KL1 domain of human alpha-Klotho, a protein studied in aging biology. A 2017 Journal of Biological Chemistry study reported that this fragment blocks Wnt1- and Wnt3a-induced beta-catenin signaling and lowers fibrotic gene expression in kidney-cell assays.
2:00 PM PST Same-Day Laboratory Dispatch · Free Shipping Over $300
1:1 Analytical & Chemical Specifications
| Analytical Parameter | Verified Specification |
|---|---|
| CAS Number | Not assigned / Not published |
| Molecular Formula | C149H203N39O43 |
| Molecular Weight | 3228.48 g/mol (Da) |
| Amino Acid Sequence | FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG (Phe57-Lys86 of human α-Klotho KL1 domain, 30 AA) |
| Chromatographic Purity (RP-HPLC) | >=99.0% Peak Area (Observed Lot 2026KLOKP15A: 99.2%) |
| Identity Verification | Electrospray Ionization Mass Spectrometry (ESI-MS) |
| Physical Form | Lyophilized Powder in Sealed Desiccated Glass Vial |
| Recommended Storage | -20°C Desiccated & Protected from Light |
| Regulatory Classification | Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use |
| Lot Traceability | Lot 2026KLOKP15A (Tested 2026-03-14) — Verify Dataset in COA Library → |
Lot-Specific Certificate of Analysis (COA)
In Vitro Laboratory Research Scope
Typical laboratory uses: Wnt/beta-catenin reporter assays, fibrotic gene-expression studies in kidney fibroblast cultures, and Klotho-FGFR co-receptor binding. For in-vitro laboratory research only. Not for human or animal use.
Analytical Verification & Storage Parameters for Klotho KP1
How is the chromatographic purity of Klotho KP1 (5MG) verified?
Every production batch of Klotho KP1 (5MG), including active Lot 2026KLOKP15A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.2% peak area purity (retention time 13.82 min) and exact molecular mass concordance prior to catalog release.
What are the laboratory storage and stability parameters for lyophilized Klotho KP1?
Lyophilized Klotho KP1 reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles.
What are the chemical identifiers and regulatory classification of Klotho KP1?
Klotho KP1 is characterized by CAS Registry identifier Not assigned / Not published, molecular formula C149H203N39O43, and theoretical molecular weight 3228.48 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use.
Primary Scientific Literature & Preclinical Citations
Peer-ReviewedThe following peer-reviewed scientific publications report preclinical investigations into the biochemical mechanisms and receptor pharmacology of this compound. Regenerative Health Peptides supplies this material strictly for in-vitro laboratory research.
Laboratory Testing Guides & Documentation
View All Guides →Similar Research Peptides
TB-500
TB-500 is supplied as thymosin beta-4, a naturally occurring 43-amino-acid protein that binds actin, the…
Selank
Selank is a synthetic 7-amino-acid peptide based on tuftsin, a natural immune-system peptide, with a…
MOTS-c
MOTS-c is a 16-amino-acid peptide encoded in mitochondrial DNA, the genetic material of the cell's…
NAD⁺
NAD⁺ (nicotinamide adenine dinucleotide) is a small molecule found in every living cell. It helps…
