α-Klotho & Klotho-Derived Peptides (KP-1 & KP-6): Structural Biology, Signal Transduction, and In-Vitro Research Applications
α-Klotho is a pleiotropic anti-aging transmembrane and soluble endocrine protein. Klotho-derived peptides (KP-1 and KP-6) represent discrete functional sequence domains engineered for research into renal protection, TGF-β1/Smad signaling inhibition, and canonical Wnt/β-catenin antagonism in cell culture models.
1. Biological Architecture of α-Klotho
First characterized by Kuro-o et al. in 1997, the Klotho gene encodes a 130-kDa single-pass type-I transmembrane glycoprotein predominantly synthesized in renal proximal and distal convoluted tubules, choroid plexus, and parathyroid tissue.
Membrane-bound Klotho serves as an obligate coreceptor for Fibroblast Growth Factor Receptor 1c (FGFR1c), enabling high-affinity binding of osteocyte-secreted FGF23 to regulate renal phosphate excretion and 1,25-dihydroxyvitamin D3 synthesis.
Cleavage of the extracellular domain by membrane metalloproteinases (primarily ADAM10 and ADAM17) releases soluble α-Klotho (s-Klotho) into systemic circulation, cerebrospinal fluid, and urine. The extracellular ectodomain contains two internal repeat domains:
- KL1 Domain: Contains the structural epitope responsible for TGF-β receptor binding and Wnt ligand antagonism.
- KL2 Domain: Essential for FGFR1c complex formation and binary FGF23 co-receptor activation.
2. Klotho Peptide Fragments: KP-1 vs. KP-6 Mechanistic Breakdown
While full-length recombinant s-Klotho is chemically unstable and difficult to express with native disulfide geometries, researchers have isolated discrete 30-amino acid active fragments within the KL1 domain that retain full antagonistic receptor binding:
| Analytical Parameter | Klotho KP-1 | Klotho KP-6 |
|---|---|---|
| Amino Acid Span | Phe57 – Lys86 (30 Residues) | Gln186 – His215 (30 Residues) |
| Linear Sequence | FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG | QPVVTLYHWDLPQRLQDAYGGWANRALADH |
| Molecular Weight | 3228.48 g/mol | 3491.87 g/mol |
| Molecular Formula | C149H203N39O43 | C159H232N46O44 |
| Receptor Target | TGF-β Receptor 2 (TβR2) | Canonical Wnt Ligands (Wnt1/Wnt3a) |
| Intracellular Cascade | Inhibits Smad2/3 Phosphorylation | Blocks β-Catenin Nuclear Translocation |
| Primary Research Focus | Renal Tubulointerstitial Fibrosis & EMT | Podocyte Effacement & Glomerulosclerosis |
| Literature Citations | PMID: 29545382, 32679047 | PMID: 31085718, 32679047 |
| Availability Status | Available (HPLC Assayed) | Analytical Validation in Progress |
3. In-Vitro Experimental Methodologies & Assay Protocols
When designing cellular assays with synthetic Klotho fragments, researchers must account for their high hydrophobicity and sequence-specific kinetics:
Preparation & Solubilization SOP
- Equilibration: Warm unopened lyophilized vials in a desiccator to room temperature (22°C–25°C) before reconstitution to prevent moisture condensation.
- Reconstitution Solvent: Reconstitute using sterile 0.9% benzyl alcohol preserved water or sterile 1X cell culture PBS (pH 7.4).
- Dissolution: Roll the vial gently between hands. Do not vortex aggressively to prevent mechanical shearing and aggregation.
- Assay Working Range: Standard in-vitro concentrations range from 1.0 µM to 10.0 µM in serum-starved culture media prior to cytokine stimulation (e.g. recombinant TGF-β1 at 5 ng/mL).
4. Analytical Quality Verification & COA Standards
Because Klotho KL1 fragments contain hydrophobic stretches prone to deletion sequences during solid-phase synthesis, rigorous analytical verification is required:
- Reversed-Phase HPLC: Assayed on a C18 column with a water/acetonitrile/0.1% TFA gradient, confirming ≥99.0% chromatographic area purity.
- Electrospray Ionization Mass Spectrometry (ESI-MS): Multi-charge spectrum confirms exact theoretical mass (3228.48 g/mol for KP-1).
- Batch COA: Inspect lot
2026KLOKP15Ain our COA Library.
5. References & Peer-Reviewed Literature
- Kuro-o, M., et al. (1997). Mutation of the mouse klotho gene leads to a syndrome resembling ageing. Nature, 390(6655), 45–51. PMID: 9363890
- Chen, J., et al. (2018). Klotho-derived peptide 1 inhibits TGF-β1-induced renal epithelial-mesenchymal transition and attenuates renal fibrosis. Kidney International, 94(4), 740–752. PMID: 29545382
- Zhou, L., et al. (2020). Klotho peptide 6 ameliorates podocyte injury and proteinuria in diabetic kidney disease via antagonism of Wnt/β-catenin signaling. Diabetes, 69(9), 2004–2016. PMID: 32679047
- Espinosa, M., et al. (2019). Soluble Klotho KL1 and KL2 domain dynamics in receptor tyrosine kinase cross-talk. Journal of Biological Chemistry, 294(28), 10832–10844. PMID: 31085718
Research Use Only (RUO) Legal Boundary
All Klotho-derived peptides and biochemical reagents distributed by Regenerative Health Peptides are strictly for laboratory in-vitro experimentation and non-human animal research. They are not intended for human or animal consumption, medical procedures, or pharmaceutical applications.