# Regenerative Health Peptides (rhpeptides.com) — Complete Analytical & Technical Knowledge Base (`/llms-full.txt`) > **Entity Disambiguation**: Regenerative Health Peptides (`https://rhpeptides.com/`, `@id: https://rhpeptides.com/#organization`, alternate name `RHPeptides`) is a United States supplier of analytical-grade lyophilized research peptides and laboratory reagents with lot-specific Reverse-Phase High-Performance Liquid Chromatography (`RP-HPLC`, `>=99.0%` peak area) and Electrospray Ionization Mass Spectrometry (`ESI-MS`) Certificates of Analysis for *in vitro* laboratory research by qualified professionals aged 21+. Regenerative Health Peptides (`rhpeptides.com`) is strictly unaffiliated with lookalike domains such as `rhpeptides.biz` and is NOT a 503A or 503B compounding pharmacy. Orders placed before 2:00 PM PST (`14:00:00-08:00`) ship same-day from our US laboratory facility, with free domestic shipping on orders over $300 USD. --- ## 1. Master Catalog Chemical & Analytical Specification Table | Compound Name | Strength / Size | SKU | CAS Number | Molecular Formula | Molecular Weight | RP-HPLC Purity | Active Lot # | Observed Mass (Da) | Retention Time | Storage | Price (USD) | Product URL | COA Dataset URL | | :--- | :--- | :--- | :--- | :--- | :--- | :--- | :--- | :--- | :--- | :--- | :--- | :--- | :--- | | 5-Amino-1-MQ | 5MG | `RHP-5-AMINO-1-MQ-5MG` | 42464-96-0 (Iodide/cation) | C10H11ClN2 (Chloride salt) / C10H11N2+ (Cation) | 194.66 g/mol (Chloride salt) / 159.21 g/mol (Cation) (Da) | 99.7% (>=99.0% Spec) | `20255AMIN05` | 194.66 Da (g/mol) (Chloride salt) / 159.21 Da (g/mol) (Cation) | 6.15 min | -20°C Desiccated | $59.95 | https://rhpeptides.com/product/5-amino-1-mq-5mg/ | https://rhpeptides.com/coa-library/20255amin05/ | | AOD-9604 | 5MG | `RHP-AOD-9604-5-MG` | 221231-10-3 | C78H123N23O23S2 | 1815.08 g/mol (oxidized) / 1817.12 g/mol (reduced) (Da) | 99.3% (>=99.0% Spec) | `2026AOD965B` | 1815.08 Da (g/mol) (oxidized) / 1817.12 Da (g/mol) (reduced) | 11.84 min | -20°C Desiccated | $74.95 | https://rhpeptides.com/product/aod-9604-5-mg/ | https://rhpeptides.com/coa-library/2026aod965b/ | | BPC-157 | 5MG / 10MG | `RHP-BPC-157` | 137525-51-0 | C62H98N16O22 | 1419.535 g/mol (Da) | 99.5% (>=99.0% Spec) | `2026BPC155A` | 1419.535 Da (g/mol) | 9.84 min | -20°C Desiccated | $44.95 | https://rhpeptides.com/product/bpc-157/ | https://rhpeptides.com/coa-library/2026bpc155a/ | | BPC-157 + TB-500 Blend | 5MG / 5MG | `RHP-BPC-157-TB-500-BLEND` | BPC-157: 137525-51-0 | TB-500 (Thymosin Beta-4): 77591-33-4 | BPC-157: C62H98N16O22 | TB-500 (Thymosin Beta-4): C212H350N56O78S | BPC-157: 1419.53 g/mol | TB-500 (Thymosin Beta-4): 4963.50 g/mol | 99.4% (>=99.0% Spec) | `2026BPCTB10B` | BPC-157: 1419.53 Da | TB-500 (Thymosin Beta-4): 4963.50 Da | 10.62 min | -20°C Desiccated | $59.95 | https://rhpeptides.com/product/bpc-157-tb-500-blend/ | https://rhpeptides.com/coa-library/2026bpctb10b/ | | CJC-1295 (No DAC) | 5MG / 10MG | `RHP-CJC-1295-NO-DAC` | 863288-34-0 (Note: CAS 863288-34-0 officially assigned to CJC-1295 with DAC; Mod GRF 1-29 lacks unique CAS) | C152H252N44O42 | 3367.97 g/mol (Da) | 99.3% (>=99.0% Spec) | `2026CJC125A` | 3367.97 Da (g/mol) | 12.74 min | -20°C Desiccated | $59.95 | https://rhpeptides.com/product/cjc-1295-no-dac/ | https://rhpeptides.com/coa-library/2026cjc125a/ | | Dihexa | 10MG | `RHP-DIHEXA-5MG` | 1401708-83-5 | C27H44N4O5 | 504.67 g/mol (Da) | 99.6% (>=99.0% Spec) | `2026DIHEX10A` | 504.67 Da (g/mol) | 8.34 min | -20°C Desiccated | $69.95 | https://rhpeptides.com/product/dihexa-5mg/ | https://rhpeptides.com/coa-library/2026dihex10a/ | | Epithalon | 10MG | `RHP-EPITHALON-10MG` | 307297-39-8 | C14H22N4O9 | 390.35 g/mol (Da) | 99.6% (>=99.0% Spec) | `V251028-17` | 390.35 Da (g/mol) | 5.88 min | -20°C Desiccated | $49.95 | https://rhpeptides.com/product/epithalon-10mg/ | https://rhpeptides.com/coa-library/v251028-17/ | | GHK-Cu | 50MG | `RHP-GHK-CU-50MG` | 49557-75-7 (GHK-Cu) / 72957-37-0 (Free GHK) | C14H22CuN6O4 (Complex) / C14H24N6O4 (Free GHK) | 401.91 g/mol (Complex) / 340.38 g/mol (Free GHK) (Da) | 99.5% (>=99.0% Spec) | `2026GHKCU50A` | 401.91 Da (g/mol) (Complex) / 340.38 Da (g/mol) (Free GHK) | 5.44 min | -20°C Desiccated | $49.95 | https://rhpeptides.com/product/ghk-cu-50mg/ | https://rhpeptides.com/coa-library/2026ghkcu50a/ | | GLOW | 10MG / 10MG / 50MG | `RHP-GLOW-70MG` | BPC-157: 137525-51-0 | TB-500 (Thymosin Beta-4): 77591-33-4 | GHK-Cu: 49557-75-7 | BPC-157: C62H98N16O22 | TB-500 (Thymosin Beta-4): C212H350N56O78S | GHK-Cu: C14H22CuN6O4 | BPC-157: 1419.53 g/mol | TB-500 (Thymosin Beta-4): 4963.50 g/mol | GHK-Cu: 401.91 g/mol | 99.5% (>=99.0% Spec) | `2026GLOW70A` | BPC-157: 1419.53 Da | TB-500 (Thymosin Beta-4): 4963.50 Da | GHK-Cu: 401.91 Da | 10.41 min | -20°C Desiccated | $124.95 | https://rhpeptides.com/product/glow-70mg/ | https://rhpeptides.com/coa-library/2026glow70a/ | | GLP1-S | 10MG | `RHP-GLP-1S-10MG` | 910463-68-2 | C187H291N45O59 | 4113.64 g/mol (Da) | 99.4% (>=99.0% Spec) | `10718` | 4113.64 Da (g/mol) | 14.22 min | -20°C Desiccated | $104.95 | https://rhpeptides.com/product/glp-1s-10mg/ | https://rhpeptides.com/coa-library/10718/ | | GLP2-T | 10MG / 30MG / 60MG | `RHP-GLP2-T` | 2023788-19-2 | C225H348N48O68 | 4813.5 g/mol (Da) | 99.4% (>=99.0% Spec) | `2026GLP2T30A` | 4813.5 Da (g/mol) | 14.86 min | -20°C Desiccated | $104.95 | https://rhpeptides.com/product/glp2-t/ | https://rhpeptides.com/coa-library/2026glp2t30a/ | | Gold-3 | 15MG / 30MG | `RHP-GOLD-3` | 2381089-83-2 (Retatrutide) | C221H342N46O68 | 4731.33 g/mol (Da) | 99.3% (>=99.0% Spec) | `2026GLP3R15A` | 4731.33 Da (g/mol) | 15.08 min | -20°C Desiccated | $169.95 | https://rhpeptides.com/product/gold-3/ | https://rhpeptides.com/coa-library/2026glp3r15a/ | | IGF1-LR3 | 1MG | `RHP-IGF1-LR3-1MG` | 949837-08-3 | C400H625N111O115S9 | 9117.5 g/mol (Da) | 99.1% (>=99.0% Spec) | `2025IGF1L01` | 9117.5 Da (g/mol) | 16.40 min | -20°C Desiccated | $79.95 | https://rhpeptides.com/product/igf1-lr3-1mg/ | https://rhpeptides.com/coa-library/2025igf1l01/ | | Ipamorelin | 5MG / 10MG | `RHP-IPAMORELIN` | 170851-70-4 | C38H49N9O5 | 711.86 g/mol (Da) | 99.6% (>=99.0% Spec) | `2026IPAMO5A` | 711.86 Da (g/mol) | 8.92 min | -20°C Desiccated | $44.95 | https://rhpeptides.com/product/ipamorelin/ | https://rhpeptides.com/coa-library/2026ipamo5a/ | | Ipamorelin + CJC-1295 (No DAC) | 5MG / 5MG | `RHP-IPAMORELIN-CJC-1295-5-MG-5-MG` | Ipamorelin: 170851-70-4 | CJC-1295 No DAC (Mod GRF 1-29): 863288-34-0 | Ipamorelin: C38H49N9O5 | CJC-1295 No DAC (Mod GRF 1-29): C152H252N44O42 | Ipamorelin: 711.86 g/mol | CJC-1295 No DAC (Mod GRF 1-29): 3367.97 g/mol | 99.4% (>=99.0% Spec) | `2026IPACJ10B` | Ipamorelin: 711.86 Da | CJC-1295 No DAC (Mod GRF 1-29): 3367.97 Da | 10.95 min | -20°C Desiccated | $94.95 | https://rhpeptides.com/product/ipamorelin-cjc-1295-5-mg-5-mg/ | https://rhpeptides.com/coa-library/2026ipacj10b/ | | Kisspeptin | 10MG | `RHP-KISSPEPTIN-10MG` | 374675-21-5 | C63H83N17O14 | 1302.45 g/mol (Da) | 99.1% (>=99.0% Spec) | `2026KISSP10A` | 1302.45 Da (g/mol) | 9.45 min | -20°C Desiccated | $59.95 | https://rhpeptides.com/product/kisspeptin-10mg/ | https://rhpeptides.com/coa-library/2026kissp10a/ | | Klotho KP1 | 5MG | `RHP-KLOTHO-KP1-5MG` | Not assigned / Not published | C149H203N39O43 | 3228.48 g/mol (Da) | 99.2% (>=99.0% Spec) | `2026KLOKP15A` | 3228.48 Da (g/mol) | 13.82 min | -20°C Desiccated | $264.95 | https://rhpeptides.com/product/klotho-kp1-5mg/ | https://rhpeptides.com/coa-library/2026klokp15a/ | | KLOW | 10MG / 10MG / 10MG / 50MG | `RHP-KLOW-80MG` | BPC-157: 137525-51-0 | TB-500 (Thymosin Beta-4): 77591-33-4 | KPV: 67727-97-3 | GHK-Cu: 49557-75-7 | BPC-157: C62H98N16O22 | TB-500 (Thymosin Beta-4): C212H350N56O78S | KPV: C16H29N5O4 | GHK-Cu: C14H22CuN6O4 | BPC-157: 1419.53 g/mol | TB-500 (Thymosin Beta-4): 4963.50 g/mol | KPV: 355.43 g/mol | GHK-Cu: 401.91 g/mol | 99.4% (>=99.0% Spec) | `2026KLOW80A` | BPC-157: 1419.53 Da | TB-500 (Thymosin Beta-4): 4963.50 Da | KPV: 355.43 Da | GHK-Cu: 401.91 Da | 10.88 min | -20°C Desiccated | $139.95 | https://rhpeptides.com/product/klow-80mg/ | https://rhpeptides.com/coa-library/2026klow80a/ | | Melanotan 1 | 10MG | `RHP-MELANOTAN-1-10MG` | 75921-69-6 | C78H111N21O19 | 1646.85 g/mol (Da) | 99.3% (>=99.0% Spec) | `2026MELAN10A` | 1646.85 Da (g/mol) | 10.18 min | -20°C Desiccated | $54.95 | https://rhpeptides.com/product/melanotan-1-10mg/ | https://rhpeptides.com/coa-library/2026melan10a/ | | MOTS-c | 10MG / 40MG | `RHP-MOTS-C-10-MG` | 1627580-64-6 | C101H152N28O22S2 | 2174.62 g/mol (Da) | 99.2% (>=99.0% Spec) | `74821` | 2174.62 Da (g/mol) | 9.78 min | -20°C Desiccated | $69.95 | https://rhpeptides.com/product/mots-c-10-mg/ | https://rhpeptides.com/coa-library/74821/ | | MTP-131 | 10MG | `RHP-MTP-131-10MG` | 736992-21-5 | C32H49N9O5 | 639.8 g/mol (Da) | 99.5% (>=99.0% Spec) | `2026SS3110A` | 639.8 Da (g/mol) | 7.64 min | -20°C Desiccated | $79.95 | https://rhpeptides.com/product/mtp-131-10mg/ | https://rhpeptides.com/coa-library/2026ss3110a/ | | NAD⁺ | 500MG | `RHP-NAD-500MG` | 53-84-9 | C21H27N7O14P2 | 663.43 g/mol (Da) | 99.6% (>=99.0% Spec) | `75442` | 663.43 Da (g/mol) | 4.62 min | -20°C Desiccated | $99.95 | https://rhpeptides.com/product/nad-500mg/ | https://rhpeptides.com/coa-library/75442/ | | Reconstitution Solution | 3ML / 10ML | `RHP-BAC-WATER` | 7732-18-5 (Water) / 100-51-6 (Benzyl alcohol) | H2O (99.1% w/v) / C7H8O (0.9% w/v) | 18.015 g/mol (H2O) / 108.14 g/mol (C7H8O) | 99.9% (>=99.0% Spec) | `2138-10-2025` | 18.015 Da (H2O) / 108.14 Da (C7H8O) | 3.10 min | -20°C Desiccated | $7.95 | https://rhpeptides.com/product/bac-water/ | https://rhpeptides.com/coa-library/2138-10-2025/ | | Selank | 10MG | `RHP-SELANK-10MG` | 129954-34-3 | C33H57N11O9 | 751.9 g/mol (Da) | 99.5% (>=99.0% Spec) | `2026SELAN10A` | 751.9 Da (g/mol) | 7.48 min | -20°C Desiccated | $59.95 | https://rhpeptides.com/product/selank-10mg/ | https://rhpeptides.com/coa-library/2026selan10a/ | | Semax | 10MG | `RHP-SEMAX-10MG` | 80714-61-0 | C37H51N9O10S | 813.92 g/mol (Da) | 99.5% (>=99.0% Spec) | `2026SEMAX10A` | 813.92 Da (g/mol) | 7.92 min | -20°C Desiccated | $59.95 | https://rhpeptides.com/product/semax-10mg/ | https://rhpeptides.com/coa-library/2026semax10a/ | | Sermorelin | 5MG / 10MG | `RHP-SERMORELIN` | 86168-78-7 | C149H246N44O42S | 3357.9 g/mol (Da) | 99.4% (>=99.0% Spec) | `2026SERMO10A` | 3357.9 Da (g/mol) | 12.18 min | -20°C Desiccated | $44.95 | https://rhpeptides.com/product/sermorelin/ | https://rhpeptides.com/coa-library/2026sermo10a/ | | TB-500 | 5MG / 10MG | `RHP-TB-500` | 77591-33-4 (Thymosin Beta-4; TB-500 fragment Ac-LKKTETQ is 889.0 g/mol, often conflated) | C212H350N56O78S | 4963.5 g/mol (Da) | 99.3% (>=99.0% Spec) | `2026TB5005A` | 4963.5 Da (g/mol) | 11.56 min | -20°C Desiccated | $49.95 | https://rhpeptides.com/product/tb-500/ | https://rhpeptides.com/coa-library/2026tb5005a/ | | TH9507 | 10MG | `RHP-TH9507-10MG` | 218949-48-5 | C221H366N72O67S (Formula for 44-AA) | 5135.9 g/mol (MW for 44-AA) (Da) | 99.2% (>=99.0% Spec) | `75443` | 5135.9 Da (g/mol) (MW for 44-AA) | 13.45 min | -20°C Desiccated | $94.95 | https://rhpeptides.com/product/th9507-10mg/ | https://rhpeptides.com/coa-library/75443/ | | TH9507 / Ipamorelin Blend | 6MG / 2MG | `RHP-TH9507-IPAMORELIN-BLEND-8MG-6MG-2MG` | TH9507 (Tesamorelin): 218949-48-5 | Ipamorelin: 170851-70-4 | TH9507 (Tesamorelin): C221H366N72O67S | Ipamorelin: C38H49N9O5 | TH9507 (Tesamorelin): 5135.90 g/mol | Ipamorelin: 711.86 g/mol | 99.3% (>=99.0% Spec) | `2026TESAIPA62A` | TH9507 (Tesamorelin): 5135.90 Da | Ipamorelin: 711.86 Da | 13.10 min | -20°C Desiccated | $94.95 | https://rhpeptides.com/product/th9507-ipamorelin-blend-8mg-6mg-2mg/ | https://rhpeptides.com/coa-library/2026tesaipa62a/ | | Thymosin Alpha-1 | 10MG | `RHP-THYMOSIN-ALPHA-1-10MG` | 62304-98-7 | C129H215N33O55 | 3108.3 g/mol (Da) | 99.4% (>=99.0% Spec) | `2026THYMO10A` | 3108.3 Da (g/mol) | 11.12 min | -20°C Desiccated | $79.95 | https://rhpeptides.com/product/thymosin-alpha-1-10mg/ | https://rhpeptides.com/coa-library/2026thymo10a/ | | VIP | 10MG | `RHP-VIP-10MG` | 40077-57-4 | C147H238N44O42S | 3325.8 g/mol (Da) | 99.1% (>=99.0% Spec) | `2026VIP10A` | 3325.8 Da (g/mol) | 12.30 min | -20°C Desiccated | $59.95 | https://rhpeptides.com/product/vip-10mg/ | https://rhpeptides.com/coa-library/2026vip10a/ | --- ## 2. Detailed Compound Monographs, Sequences & Active COA Datasets ### 5-Amino-1-MQ (5MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/5-amino-1-mq-5mg#product` - **Direct Product URL**: https://rhpeptides.com/product/5-amino-1-mq-5mg/ - **SKU / MPN**: `RHP-5-AMINO-1-MQ-5MG` / `RHP-20255AMIN05` - **Price (USD)**: $59.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/20255amin05#dataset` (https://rhpeptides.com/coa-library/20255amin05/) - **Active Lot Number**: `20255AMIN05` (Published: `2025-11-12`, Observed RP-HPLC Purity: `99.7%`, Retention Time: `6.15 min`, Observed Mass: `194.66 Da (g/mol) (Chloride salt) / 159.21 Da (g/mol) (Cation)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/20255AMIN05-1-788x1024.jpg - **Scientific Overview**: 5-Amino-1-MQ (5-amino-1-methylquinolinium) is a small molecule, not a peptide. It is studied as an inhibitor of NNMT, an enzyme involved in cell metabolism. A published study in mouse muscle cells reported that blocking NNMT raised intracellular NAD⁺ and SAM levels. - **In Vitro Research Application**: Typical laboratory uses: NNMT enzyme-inhibition assays and studies of NAD⁺ salvage and methylation (SAM/SAH) balance in cultured cells. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 42464-96-0 (Iodide/cation) - **Molecular Formula**: C10H11ClN2 (Chloride salt) / C10H11N2+ (Cation) - **Molecular Weight**: 194.66 g/mol (Chloride salt) / 159.21 g/mol (Cation) (Da) - **Amino Acid Sequence**: 5-amino-1-methylquinolinium chloride (Quinolinium small molecule salt / non-peptide) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 20255AMIN05: 99.7%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of 5-Amino-1-MQ (5MG) verified?** A: Every production batch of 5-Amino-1-MQ (5MG), including active Lot 20255AMIN05, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.7% peak area purity (retention time 6.15 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized 5-Amino-1-MQ?** A: Lyophilized 5-Amino-1-MQ reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of 5-Amino-1-MQ?** A: 5-Amino-1-MQ is characterized by CAS Registry identifier 42464-96-0 (Iodide/cation), molecular formula C10H11ClN2 (Chloride salt) / C10H11N2+ (Cation), and theoretical molecular weight 194.66 g/mol (Chloride salt) / 159.21 g/mol (Cation) (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### AOD-9604 (5MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/aod-9604-5-mg#product` - **Direct Product URL**: https://rhpeptides.com/product/aod-9604-5-mg/ - **SKU / MPN**: `RHP-AOD-9604-5-MG` / `RHP-2026AOD965B` - **Price (USD)**: $74.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026aod965b#dataset` (https://rhpeptides.com/coa-library/2026aod965b/) - **Active Lot Number**: `2026AOD965B` (Published: `2026-02-14`, Observed RP-HPLC Purity: `99.3%`, Retention Time: `11.84 min`, Observed Mass: `1815.08 Da (g/mol) (oxidized) / 1817.12 Da (g/mol) (reduced)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/uploads/2026/08/2026AOD965B-pdf.jpg - **Scientific Overview**: AOD-9604 is a short synthetic peptide (16 amino acids) based on the tail end of human growth hormone, with an added tyrosine for stability. Published research in rodent fat cells reported that it stimulates lipolysis (the breakdown of stored fat) without changing blood glucose or IGF-1 levels in the animals studied. - **In Vitro Research Application**: Typical laboratory uses: studying beta-3 adrenergic receptor signaling, fat-cell (adipocyte) metabolism, and cartilage-cell matrix production in cell culture. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 221231-10-3 - **Molecular Formula**: C78H123N23O23S2 - **Molecular Weight**: 1815.08 g/mol (oxidized) / 1817.12 g/mol (reduced) (Da) - **Amino Acid Sequence**: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe (Disulfide Cys7-Cys14) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026AOD965B: 99.3%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of AOD-9604 (5MG) verified?** A: Every production batch of AOD-9604 (5MG), including active Lot 2026AOD965B, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.3% peak area purity (retention time 11.84 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized AOD-9604?** A: Lyophilized AOD-9604 reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of AOD-9604?** A: AOD-9604 is characterized by CAS Registry identifier 221231-10-3, molecular formula C78H123N23O23S2, and theoretical molecular weight 1815.08 g/mol (oxidized) / 1817.12 g/mol (reduced) (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### BPC-157 (5MG / 10MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/bpc-157#product` - **Direct Product URL**: https://rhpeptides.com/product/bpc-157/ - **SKU / MPN**: `RHP-BPC-157` / `RHP-2026BPC155A` - **Price (USD)**: $44.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026bpc155a#dataset` (https://rhpeptides.com/coa-library/2026bpc155a/) - **Active Lot Number**: `2026BPC155A` (Published: `2026-03-08`, Observed RP-HPLC Purity: `99.5%`, Retention Time: `9.84 min`, Observed Mass: `1419.535 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026BPC155A-788x1024.jpg - **Scientific Overview**: BPC-157 is a synthetic 15-amino-acid peptide whose sequence comes from a protein found in human gastric juice. Published research in rat tendon-derived cells reported that it promotes fibroblast migration and activates the FAK-paxillin signaling pathway. - **In Vitro Research Application**: Typical laboratory uses: tendon fibroblast migration assays, FAK/paxillin phosphorylation, and nitric-oxide synthase regulation in cell models. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 137525-51-0 - **Molecular Formula**: C62H98N16O22 - **Molecular Weight**: 1419.535 g/mol (Da) - **Amino Acid Sequence**: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (15 AA) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026BPC155A: 99.5%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of BPC-157 (5MG / 10MG) verified?** A: Every production batch of BPC-157 (5MG / 10MG), including active Lot 2026BPC155A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.5% peak area purity (retention time 9.84 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized BPC-157?** A: Lyophilized BPC-157 reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of BPC-157?** A: BPC-157 is characterized by CAS Registry identifier 137525-51-0, molecular formula C62H98N16O22, and theoretical molecular weight 1419.535 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### BPC-157 + TB-500 Blend (5MG / 5MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/bpc-157-tb-500-blend#product` - **Direct Product URL**: https://rhpeptides.com/product/bpc-157-tb-500-blend/ - **SKU / MPN**: `RHP-BPC-157-TB-500-BLEND` / `RHP-2026BPCTB10B` - **Price (USD)**: $59.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026bpctb10b#dataset` (https://rhpeptides.com/coa-library/2026bpctb10b/) - **Active Lot Number**: `2026BPCTB10B` (Published: `2026-03-15`, Observed RP-HPLC Purity: `99.4%`, Retention Time: `10.62 min`, Observed Mass: `BPC-157: 1419.53 Da | TB-500 (Thymosin Beta-4): 4963.50 Da`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026BPCTB10B-pdf-791x1024.jpg - **Scientific Overview**: A two-peptide research blend of BPC-157 and TB-500. Published research has studied BPC-157 in tendon-cell and angiogenesis (new blood vessel) models, and TB-500 (thymosin beta-4) in actin-binding and cell-migration assays. Each component is listed separately below. - **In Vitro Research Application**: Typical laboratory uses: cell-migration and angiogenic-signaling assays, and actin-dynamics studies in tissue-culture models. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: BPC-157: 137525-51-0 | TB-500 (Thymosin Beta-4): 77591-33-4 - **Molecular Formula**: BPC-157: C62H98N16O22 | TB-500 (Thymosin Beta-4): C212H350N56O78S - **Molecular Weight**: BPC-157: 1419.53 g/mol | TB-500 (Thymosin Beta-4): 4963.50 g/mol - **Amino Acid Sequence**: BPC-157 (5mg / 10mg): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val | TB-500 (Thymosin Beta-4) (5mg / 10mg): Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026BPCTB10B: 99.4%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of BPC-157 + TB-500 Blend (5MG / 5MG) verified?** A: Every production batch of BPC-157 + TB-500 Blend (5MG / 5MG), including active Lot 2026BPCTB10B, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.4% peak area purity (retention time 10.62 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized BPC-157 + TB-500 Blend?** A: Lyophilized BPC-157 + TB-500 Blend reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of BPC-157 + TB-500 Blend?** A: BPC-157 + TB-500 Blend is characterized by CAS Registry identifier BPC-157: 137525-51-0 | TB-500 (Thymosin Beta-4): 77591-33-4, molecular formula BPC-157: C62H98N16O22 | TB-500 (Thymosin Beta-4): C212H350N56O78S, and theoretical molecular weight BPC-157: 1419.53 g/mol | TB-500 (Thymosin Beta-4): 4963.50 g/mol. Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### CJC-1295 (No DAC) (5MG / 10MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/cjc-1295-no-dac#product` - **Direct Product URL**: https://rhpeptides.com/product/cjc-1295-no-dac/ - **SKU / MPN**: `RHP-CJC-1295-NO-DAC` / `RHP-2026CJC125A` - **Price (USD)**: $59.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026cjc125a#dataset` (https://rhpeptides.com/coa-library/2026cjc125a/) - **Active Lot Number**: `2026CJC125A` (Published: `2026-02-19`, Observed RP-HPLC Purity: `99.3%`, Retention Time: `12.74 min`, Observed Mass: `3367.97 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026CJC125A-788x1024.jpg - **Scientific Overview**: CJC-1295 (No DAC), also called Modified GRF 1-29, is a 29-amino-acid synthetic fragment of growth-hormone-releasing hormone with four amino-acid substitutions that make it more stable. Published pituitary cell-culture research has studied its activation of the GHRH receptor and the resulting cAMP signal. - **In Vitro Research Application**: Typical laboratory uses: GHRH receptor binding, cAMP stimulation in somatotroph cultures, and DPP-IV enzymatic-resistance comparisons. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 863288-34-0 (Note: CAS 863288-34-0 officially assigned to CJC-1295 with DAC; Mod GRF 1-29 lacks unique CAS) - **Molecular Formula**: C152H252N44O42 - **Molecular Weight**: 3367.97 g/mol (Da) - **Amino Acid Sequence**: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 (Mod GRF 1-29, 29 AA) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026CJC125A: 99.3%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of CJC-1295 (No DAC) (5MG / 10MG) verified?** A: Every production batch of CJC-1295 (No DAC) (5MG / 10MG), including active Lot 2026CJC125A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.3% peak area purity (retention time 12.74 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized CJC-1295 (No DAC)?** A: Lyophilized CJC-1295 (No DAC) reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of CJC-1295 (No DAC)?** A: CJC-1295 (No DAC) is characterized by CAS Registry identifier 863288-34-0 (Note: CAS 863288-34-0 officially assigned to CJC-1295 with DAC; Mod GRF 1-29 lacks unique CAS), molecular formula C152H252N44O42, and theoretical molecular weight 3367.97 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### Dihexa (10MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/dihexa-5mg#product` - **Direct Product URL**: https://rhpeptides.com/product/dihexa-5mg/ - **SKU / MPN**: `RHP-DIHEXA-5MG` / `RHP-2026DIHEX10A` - **Price (USD)**: $69.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026dihex10a#dataset` (https://rhpeptides.com/coa-library/2026dihex10a/) - **Active Lot Number**: `2026DIHEX10A` (Published: `2026-03-01`, Observed RP-HPLC Purity: `99.6%`, Retention Time: `8.34 min`, Observed Mass: `504.67 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026DIHEX10A-pdf-791x1024.jpg - **Scientific Overview**: Dihexa is a small synthetic molecule derived from angiotensin IV (N-hexanoyl-Tyr-Ile-aminohexanoic amide). Published studies reported that it promotes dimerization of hepatocyte growth factor (HGF) and activation of its c-Met receptor, a pathway linked in neuronal cultures to dendritic-spine formation. - **In Vitro Research Application**: Typical laboratory uses: HGF binding, c-Met dimerization and autophosphorylation assays, and dendritic-spine studies in neuronal cell cultures. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 1401708-83-5 - **Molecular Formula**: C27H44N4O5 - **Molecular Weight**: 504.67 g/mol (Da) - **Amino Acid Sequence**: N-hexanoic-Tyr-Ile-(6) aminohexanoic amide (N-hexanoyl-Tyr-Ile-Ahx-NH2) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026DIHEX10A: 99.6%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of Dihexa (10MG) verified?** A: Every production batch of Dihexa (10MG), including active Lot 2026DIHEX10A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.6% peak area purity (retention time 8.34 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized Dihexa?** A: Lyophilized Dihexa reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of Dihexa?** A: Dihexa is characterized by CAS Registry identifier 1401708-83-5, molecular formula C27H44N4O5, and theoretical molecular weight 504.67 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### Epithalon (10MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/epithalon-10mg#product` - **Direct Product URL**: https://rhpeptides.com/product/epithalon-10mg/ - **SKU / MPN**: `RHP-EPITHALON-10MG` / `RHP-V251028-17` - **Price (USD)**: $49.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/v251028-17#dataset` (https://rhpeptides.com/coa-library/v251028-17/) - **Active Lot Number**: `V251028-17` (Published: `2025-10-28`, Observed RP-HPLC Purity: `99.6%`, Retention Time: `5.88 min`, Observed Mass: `390.35 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/Epithalon-10mg-V251028-17-Regenerative-Health-Report-001-700x1024.jpg - **Scientific Overview**: Epithalon (Epitalon) is a synthetic four-amino-acid peptide (Ala-Glu-Asp-Gly) based on epithalamin, a pineal-gland extract. A published study in human fibroblasts reported that it increased telomerase activity, the enzyme that maintains the protective ends of chromosomes. - **In Vitro Research Application**: Typical laboratory uses: telomerase-activity assays in human diploid cell cultures, and studies of chromatin accessibility and melatonin-synthesis pathways. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 307297-39-8 - **Molecular Formula**: C14H22N4O9 - **Molecular Weight**: 390.35 g/mol (Da) - **Amino Acid Sequence**: Ala-Glu-Asp-Gly (AEDG Tetrapeptide) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot V251028-17: 99.6%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of Epithalon (10MG) verified?** A: Every production batch of Epithalon (10MG), including active Lot V251028-17, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.6% peak area purity (retention time 5.88 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized Epithalon?** A: Lyophilized Epithalon reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of Epithalon?** A: Epithalon is characterized by CAS Registry identifier 307297-39-8, molecular formula C14H22N4O9, and theoretical molecular weight 390.35 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### GHK-Cu (50MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/ghk-cu-50mg#product` - **Direct Product URL**: https://rhpeptides.com/product/ghk-cu-50mg/ - **SKU / MPN**: `RHP-GHK-CU-50MG` / `RHP-2026GHKCU50A` - **Price (USD)**: $49.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026ghkcu50a#dataset` (https://rhpeptides.com/coa-library/2026ghkcu50a/) - **Active Lot Number**: `2026GHKCU50A` (Published: `2026-02-20`, Observed RP-HPLC Purity: `99.5%`, Retention Time: `5.44 min`, Observed Mass: `401.91 Da (g/mol) (Complex) / 340.38 Da (g/mol) (Free GHK)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026GHKCU50A-792x1024.jpg - **Scientific Overview**: GHK-Cu is a naturally occurring three-amino-acid peptide (glycyl-histidyl-lysine) bound to a copper ion, first identified in human blood plasma. Published research has examined it in cultured skin cells (fibroblasts) for effects on collagen and elastin production and on antioxidant-enzyme expression. - **In Vitro Research Application**: Typical laboratory uses: dermal fibroblast cultures, including collagen I/III synthesis, matrix-metalloproteinase regulation, and antioxidant-enzyme gene expression. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 49557-75-7 (GHK-Cu) / 72957-37-0 (Free GHK) - **Molecular Formula**: C14H22CuN6O4 (Complex) / C14H24N6O4 (Free GHK) - **Molecular Weight**: 401.91 g/mol (Complex) / 340.38 g/mol (Free GHK) (Da) - **Amino Acid Sequence**: Gly-His-Lys·Cu(II) (Copper peptide complex) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026GHKCU50A: 99.5%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of GHK-Cu (50MG) verified?** A: Every production batch of GHK-Cu (50MG), including active Lot 2026GHKCU50A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.5% peak area purity (retention time 5.44 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized GHK-Cu?** A: Lyophilized GHK-Cu reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of GHK-Cu?** A: GHK-Cu is characterized by CAS Registry identifier 49557-75-7 (GHK-Cu) / 72957-37-0 (Free GHK), molecular formula C14H22CuN6O4 (Complex) / C14H24N6O4 (Free GHK), and theoretical molecular weight 401.91 g/mol (Complex) / 340.38 g/mol (Free GHK) (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### GLOW (10MG / 10MG / 50MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/glow-70mg#product` - **Direct Product URL**: https://rhpeptides.com/product/glow-70mg/ - **SKU / MPN**: `RHP-GLOW-70MG` / `RHP-2026GLOW70A` - **Price (USD)**: $124.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026glow70a#dataset` (https://rhpeptides.com/coa-library/2026glow70a/) - **Active Lot Number**: `2026GLOW70A` (Published: `2026-03-18`, Observed RP-HPLC Purity: `99.5%`, Retention Time: `10.41 min`, Observed Mass: `BPC-157: 1419.53 Da | TB-500 (Thymosin Beta-4): 4963.50 Da | GHK-Cu: 401.91 Da`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026GLOW70A-792x1024.jpg - **Scientific Overview**: GLOW is a three-peptide research blend of BPC-157 (10 mg), TB-500 (10 mg) and GHK-Cu (50 mg), 70 mg in total. Published research has studied these compounds individually in fibroblast and tissue-repair models, looking at nitric-oxide signaling, the cell's actin skeleton, and collagen gene expression. Each component is listed separately below. - **In Vitro Research Application**: Typical laboratory uses: side-by-side study of cell migration, new-vessel (angiogenic) signaling, and collagen and extracellular-matrix gene expression in fibroblast cultures. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: BPC-157: 137525-51-0 | TB-500 (Thymosin Beta-4): 77591-33-4 | GHK-Cu: 49557-75-7 - **Molecular Formula**: BPC-157: C62H98N16O22 | TB-500 (Thymosin Beta-4): C212H350N56O78S | GHK-Cu: C14H22CuN6O4 - **Molecular Weight**: BPC-157: 1419.53 g/mol | TB-500 (Thymosin Beta-4): 4963.50 g/mol | GHK-Cu: 401.91 g/mol - **Amino Acid Sequence**: BPC-157 (10mg): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val | TB-500 (Thymosin Beta-4) (10mg): Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser | GHK-Cu (50mg): Gly-His-Lys·Cu(II) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026GLOW70A: 99.5%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of GLOW (10MG / 10MG / 50MG) verified?** A: Every production batch of GLOW (10MG / 10MG / 50MG), including active Lot 2026GLOW70A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.5% peak area purity (retention time 10.41 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized GLOW?** A: Lyophilized GLOW reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of GLOW?** A: GLOW is characterized by CAS Registry identifier BPC-157: 137525-51-0 | TB-500 (Thymosin Beta-4): 77591-33-4 | GHK-Cu: 49557-75-7, molecular formula BPC-157: C62H98N16O22 | TB-500 (Thymosin Beta-4): C212H350N56O78S | GHK-Cu: C14H22CuN6O4, and theoretical molecular weight BPC-157: 1419.53 g/mol | TB-500 (Thymosin Beta-4): 4963.50 g/mol | GHK-Cu: 401.91 g/mol. Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### GLP1-S (10MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/glp-1s-10mg#product` - **Direct Product URL**: https://rhpeptides.com/product/glp-1s-10mg/ - **SKU / MPN**: `RHP-GLP-1S-10MG` / `RHP-10718` - **Price (USD)**: $104.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/10718#dataset` (https://rhpeptides.com/coa-library/10718/) - **Active Lot Number**: `10718` (Published: `2026-01-30`, Observed RP-HPLC Purity: `99.4%`, Retention Time: `14.22 min`, Observed Mass: `4113.64 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/10718_Regenerative_Health_Peptides_GLP1-S-01-791x1024.jpg - **Scientific Overview**: GLP1-S is a long-acting synthetic analog of GLP-1 (glucagon-like peptide-1), a natural gut hormone that signals through the GLP-1 receptor. Its fatty-acid side chain lets it bind the blood protein albumin, which published medicinal-chemistry research (Lau et al., 2015) linked to a longer half-life with strong receptor potency. - **In Vitro Research Application**: Typical laboratory uses: GLP-1 receptor binding assays, cAMP signaling, and insulin-secretion models in pancreatic beta-cell lines. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 910463-68-2 - **Molecular Formula**: C187H291N45O59 - **Molecular Weight**: 4113.64 g/mol (Da) - **Amino Acid Sequence**: [Aib8,Arg34]GLP-1(7-37)-Lys(AEEAc-AEEAc-γ-Glu-17-carboxyheptadecanoyl) (Semaglutide) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 10718: 99.4%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of GLP1-S (10MG) verified?** A: Every production batch of GLP1-S (10MG), including active Lot 10718, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.4% peak area purity (retention time 14.22 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized GLP1-S?** A: Lyophilized GLP1-S reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of GLP1-S?** A: GLP1-S is characterized by CAS Registry identifier 910463-68-2, molecular formula C187H291N45O59, and theoretical molecular weight 4113.64 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### GLP2-T (10MG / 30MG / 60MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/glp2-t#product` - **Direct Product URL**: https://rhpeptides.com/product/glp2-t/ - **SKU / MPN**: `RHP-GLP2-T` / `RHP-2026GLP2T30A` - **Price (USD)**: $104.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026glp2t30a#dataset` (https://rhpeptides.com/coa-library/2026glp2t30a/) - **Active Lot Number**: `2026GLP2T30A` (Published: `2026-03-12`, Observed RP-HPLC Purity: `99.4%`, Retention Time: `14.86 min`, Observed Mass: `4813.5 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026GLP2T60B-pdf.jpg - **Scientific Overview**: GLP2-T is a synthetic 39-amino-acid peptide that activates two gut-hormone receptors, GIP and GLP-1 (a dual incretin agonist). A fatty-acid side chain lets it bind albumin. Published studies in cell lines expressing the human receptors, and in rodents, have compared its potency at each receptor. - **In Vitro Research Application**: Typical laboratory uses: comparing receptor potency at human GIP and GLP-1 receptors and measuring cAMP and beta-arrestin recruitment in recombinant cell assays. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 2023788-19-2 - **Molecular Formula**: C225H348N48O68 - **Molecular Weight**: 4813.5 g/mol (Da) - **Amino Acid Sequence**: Tyr-{Aib}-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-{Aib}-Leu-Asp-Lys-Ile-Ala-Gln-Lys({AEEAc-AEEAc-γ-Glu-19-carboxynonadecanoyl})-Ala-Phe-Val-Gln-Trp-Leu-Ile-Ala-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 (Tirzepatide, 39 AA) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026GLP2T30A: 99.4%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of GLP2-T (10MG / 30MG / 60MG) verified?** A: Every production batch of GLP2-T (10MG / 30MG / 60MG), including active Lot 2026GLP2T30A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.4% peak area purity (retention time 14.86 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized GLP2-T?** A: Lyophilized GLP2-T reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of GLP2-T?** A: GLP2-T is characterized by CAS Registry identifier 2023788-19-2, molecular formula C225H348N48O68, and theoretical molecular weight 4813.5 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### Gold-3 (15MG / 30MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/gold-3#product` - **Direct Product URL**: https://rhpeptides.com/product/gold-3/ - **SKU / MPN**: `RHP-GOLD-3` / `RHP-2026GLP3R15A` - **Price (USD)**: $169.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026glp3r15a#dataset` (https://rhpeptides.com/coa-library/2026glp3r15a/) - **Active Lot Number**: `2026GLP3R15A` (Published: `2026-03-04`, Observed RP-HPLC Purity: `99.3%`, Retention Time: `15.08 min`, Observed Mass: `4731.33 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026GLP3R15A-788x1024.jpg - **1:1 Analytical Properties**: - **CAS Number**: 2381089-83-2 (Retatrutide) - **Molecular Formula**: C221H342N46O68 - **Molecular Weight**: 4731.33 g/mol (Da) - **Amino Acid Sequence**: Tyr-{Aib}-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys({AEEAc-AEEAc-γ-Glu-19-carboxynonadecanoyl})-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly-NH2 (Retatrutide / LY3437943, 39 AA) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026GLP3R15A: 99.3%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of Gold-3 (15MG / 30MG) verified?** A: Every production batch of Gold-3 (15MG / 30MG), including active Lot 2026GLP3R15A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.3% peak area purity (retention time 15.08 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized Gold-3?** A: Lyophilized Gold-3 reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of Gold-3?** A: Gold-3 is characterized by CAS Registry identifier 2381089-83-2 (Retatrutide), molecular formula C221H342N46O68, and theoretical molecular weight 4731.33 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### IGF1-LR3 (1MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/igf1-lr3-1mg#product` - **Direct Product URL**: https://rhpeptides.com/product/igf1-lr3-1mg/ - **SKU / MPN**: `RHP-IGF1-LR3-1MG` / `RHP-2025IGF1L01` - **Price (USD)**: $79.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2025igf1l01#dataset` (https://rhpeptides.com/coa-library/2025igf1l01/) - **Active Lot Number**: `2025IGF1L01` (Published: `2025-12-09`, Observed RP-HPLC Purity: `99.1%`, Retention Time: `16.40 min`, Observed Mass: `9117.5 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2025IGF1L01-788x1024.jpg - **Scientific Overview**: IGF1-LR3 is an 83-amino-acid synthetic analog of insulin-like growth factor 1 (IGF-1), with an arginine substitution at position 3 and a 13-amino-acid extension at the start. In published myoblast studies, these changes cut binding to IGF-binding proteins by more than 100-fold, leaving more peptide available to activate the IGF-1 receptor. - **In Vitro Research Application**: Typical laboratory uses: IGF-1 receptor phosphorylation, PI3K/Akt and MAPK signaling, and IGF-binding-protein comparisons in muscle-cell cultures. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 949837-08-3 - **Molecular Formula**: C400H625N111O115S9 - **Molecular Weight**: 9117.5 g/mol (Da) - **Amino Acid Sequence**: 83-AA Recombinant IGF-1 Analog (MFPAMPLSSLFVN extension + Arg3 substitution) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2025IGF1L01: 99.1%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of IGF1-LR3 (1MG) verified?** A: Every production batch of IGF1-LR3 (1MG), including active Lot 2025IGF1L01, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.1% peak area purity (retention time 16.40 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized IGF1-LR3?** A: Lyophilized IGF1-LR3 reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of IGF1-LR3?** A: IGF1-LR3 is characterized by CAS Registry identifier 949837-08-3, molecular formula C400H625N111O115S9, and theoretical molecular weight 9117.5 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### Ipamorelin (5MG / 10MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/ipamorelin#product` - **Direct Product URL**: https://rhpeptides.com/product/ipamorelin/ - **SKU / MPN**: `RHP-IPAMORELIN` / `RHP-2026IPAMO5A` - **Price (USD)**: $44.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026ipamo5a#dataset` (https://rhpeptides.com/coa-library/2026ipamo5a/) - **Active Lot Number**: `2026IPAMO5A` (Published: `2026-02-11`, Observed RP-HPLC Purity: `99.6%`, Retention Time: `8.92 min`, Observed Mass: `711.86 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026IPAMO5A-788x1024.jpg - **Scientific Overview**: Ipamorelin is a five-amino-acid synthetic peptide that selectively activates the growth hormone secretagogue receptor (GHS-R1a, also called the ghrelin receptor). Published pituitary-cell and animal studies reported that it prompts growth hormone release without raising ACTH or cortisol. - **In Vitro Research Application**: Typical laboratory uses: GHS-R1a receptor-activation assays and pituitary somatotroph cell signaling. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 170851-70-4 - **Molecular Formula**: C38H49N9O5 - **Molecular Weight**: 711.86 g/mol (Da) - **Amino Acid Sequence**: Aib-His-D-2Nal-D-Phe-Lys-NH2 (Pentapeptide) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026IPAMO5A: 99.6%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of Ipamorelin (5MG / 10MG) verified?** A: Every production batch of Ipamorelin (5MG / 10MG), including active Lot 2026IPAMO5A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.6% peak area purity (retention time 8.92 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized Ipamorelin?** A: Lyophilized Ipamorelin reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of Ipamorelin?** A: Ipamorelin is characterized by CAS Registry identifier 170851-70-4, molecular formula C38H49N9O5, and theoretical molecular weight 711.86 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### Ipamorelin + CJC-1295 (No DAC) (5MG / 5MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/ipamorelin-cjc-1295-5-mg-5-mg#product` - **Direct Product URL**: https://rhpeptides.com/product/ipamorelin-cjc-1295-5-mg-5-mg/ - **SKU / MPN**: `RHP-IPAMORELIN-CJC-1295-5-MG-5-MG` / `RHP-2026IPACJ10B` - **Price (USD)**: $94.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026ipacj10b#dataset` (https://rhpeptides.com/coa-library/2026ipacj10b/) - **Active Lot Number**: `2026IPACJ10B` (Published: `2026-03-10`, Observed RP-HPLC Purity: `99.4%`, Retention Time: `10.95 min`, Observed Mass: `Ipamorelin: 711.86 Da | CJC-1295 No DAC (Mod GRF 1-29): 3367.97 Da`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/uploads/2026/08/2026IPACJ10B-pdf.jpg - **Scientific Overview**: A research combination of two peptides that act on different receptors in pituitary cells: Ipamorelin (5 mg), which activates the ghrelin receptor (GHS-R1a), and CJC-1295 No DAC (5 mg), a modified fragment of growth-hormone-releasing hormone. Published cell-culture work has studied how each one drives growth hormone signaling. Each component is listed separately below. - **In Vitro Research Application**: Typical laboratory uses: comparing how pituitary cell cultures respond to ghrelin-receptor and GHRH-receptor activation, including cAMP and calcium signaling. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: Ipamorelin: 170851-70-4 | CJC-1295 No DAC (Mod GRF 1-29): 863288-34-0 - **Molecular Formula**: Ipamorelin: C38H49N9O5 | CJC-1295 No DAC (Mod GRF 1-29): C152H252N44O42 - **Molecular Weight**: Ipamorelin: 711.86 g/mol | CJC-1295 No DAC (Mod GRF 1-29): 3367.97 g/mol - **Amino Acid Sequence**: Ipamorelin (5mg): Aib-His-D-2Nal-D-Phe-Lys-NH2 | CJC-1295 No DAC (Mod GRF 1-29) (5mg): Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026IPACJ10B: 99.4%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of Ipamorelin + CJC-1295 (No DAC) (5MG / 5MG) verified?** A: Every production batch of Ipamorelin + CJC-1295 (No DAC) (5MG / 5MG), including active Lot 2026IPACJ10B, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.4% peak area purity (retention time 10.95 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized Ipamorelin + CJC-1295 (No DAC)?** A: Lyophilized Ipamorelin + CJC-1295 (No DAC) reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of Ipamorelin + CJC-1295 (No DAC)?** A: Ipamorelin + CJC-1295 (No DAC) is characterized by CAS Registry identifier Ipamorelin: 170851-70-4 | CJC-1295 No DAC (Mod GRF 1-29): 863288-34-0, molecular formula Ipamorelin: C38H49N9O5 | CJC-1295 No DAC (Mod GRF 1-29): C152H252N44O42, and theoretical molecular weight Ipamorelin: 711.86 g/mol | CJC-1295 No DAC (Mod GRF 1-29): 3367.97 g/mol. Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### Kisspeptin (10MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/kisspeptin-10mg#product` - **Direct Product URL**: https://rhpeptides.com/product/kisspeptin-10mg/ - **SKU / MPN**: `RHP-KISSPEPTIN-10MG` / `RHP-2026KISSP10A` - **Price (USD)**: $59.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026kissp10a#dataset` (https://rhpeptides.com/coa-library/2026kissp10a/) - **Active Lot Number**: `2026KISSP10A` (Published: `2026-02-16`, Observed RP-HPLC Purity: `99.1%`, Retention Time: `9.45 min`, Observed Mass: `1302.45 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026KISSP10A-788x1024.jpg - **Scientific Overview**: Kisspeptin-10 is the shortest fragment (10 amino acids) of the kisspeptin protein reported to activate the KISS1R (GPR54) receptor. Published work in cells expressing the human receptor linked this activation to calcium signaling and, in neuroendocrine research, to GnRH release. - **In Vitro Research Application**: Typical laboratory uses: KISS1R (GPR54) receptor-activation assays, intracellular IP3/calcium signaling, and neuroendocrine GnRH-pulse models. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 374675-21-5 - **Molecular Formula**: C63H83N17O14 - **Molecular Weight**: 1302.45 g/mol (Da) - **Amino Acid Sequence**: Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 (Kisspeptin-10, 10 AA) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026KISSP10A: 99.1%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of Kisspeptin (10MG) verified?** A: Every production batch of Kisspeptin (10MG), including active Lot 2026KISSP10A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.1% peak area purity (retention time 9.45 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized Kisspeptin?** A: Lyophilized Kisspeptin reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of Kisspeptin?** A: Kisspeptin is characterized by CAS Registry identifier 374675-21-5, molecular formula C63H83N17O14, and theoretical molecular weight 1302.45 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### Klotho KP1 (5MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/klotho-kp1-5mg#product` - **Direct Product URL**: https://rhpeptides.com/product/klotho-kp1-5mg/ - **SKU / MPN**: `RHP-KLOTHO-KP1-5MG` / `RHP-2026KLOKP15A` - **Price (USD)**: $264.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026klokp15a#dataset` (https://rhpeptides.com/coa-library/2026klokp15a/) - **Active Lot Number**: `2026KLOKP15A` (Published: `2026-03-14`, Observed RP-HPLC Purity: `99.2%`, Retention Time: `13.82 min`, Observed Mass: `3228.48 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026KLOTHOKP1A-pdf-791x1024.jpg - **Scientific Overview**: Klotho KP1 is a 30-amino-acid peptide matching a stretch of the KL1 domain of human alpha-Klotho, a protein studied in aging biology. A 2017 Journal of Biological Chemistry study reported that this fragment blocks Wnt1- and Wnt3a-induced beta-catenin signaling and lowers fibrotic gene expression in kidney-cell assays. - **In Vitro Research Application**: Typical laboratory uses: Wnt/beta-catenin reporter assays, fibrotic gene-expression studies in kidney fibroblast cultures, and Klotho-FGFR co-receptor binding. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: Not assigned / Not published - **Molecular Formula**: C149H203N39O43 - **Molecular Weight**: 3228.48 g/mol (Da) - **Amino Acid Sequence**: FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG (Phe57-Lys86 of human α-Klotho KL1 domain, 30 AA) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026KLOKP15A: 99.2%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of Klotho KP1 (5MG) verified?** A: Every production batch of Klotho KP1 (5MG), including active Lot 2026KLOKP15A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.2% peak area purity (retention time 13.82 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized Klotho KP1?** A: Lyophilized Klotho KP1 reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of Klotho KP1?** A: Klotho KP1 is characterized by CAS Registry identifier Not assigned / Not published, molecular formula C149H203N39O43, and theoretical molecular weight 3228.48 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### KLOW (10MG / 10MG / 10MG / 50MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/klow-80mg#product` - **Direct Product URL**: https://rhpeptides.com/product/klow-80mg/ - **SKU / MPN**: `RHP-KLOW-80MG` / `RHP-2026KLOW80A` - **Price (USD)**: $139.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026klow80a#dataset` (https://rhpeptides.com/coa-library/2026klow80a/) - **Active Lot Number**: `2026KLOW80A` (Published: `2026-03-20`, Observed RP-HPLC Purity: `99.4%`, Retention Time: `10.88 min`, Observed Mass: `BPC-157: 1419.53 Da | TB-500 (Thymosin Beta-4): 4963.50 Da | KPV: 355.43 Da | GHK-Cu: 401.91 Da`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026KLOW80A-788x1024.jpg - **Scientific Overview**: KLOW is a four-component research blend of BPC-157 (10 mg), TB-500 (10 mg), KPV (10 mg) and GHK-Cu (50 mg), 80 mg in total. Published research has studied these compounds individually in cell and tissue models, covering nitric-oxide signaling, the actin skeleton, NF-kB inflammatory signaling (KPV), and collagen scaffolding (GHK-Cu). Each component is listed separately below. - **In Vitro Research Application**: Typical laboratory uses: side-by-side assays of cell migration, NF-kB signaling, and extracellular-matrix gene expression in cultured cells. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: BPC-157: 137525-51-0 | TB-500 (Thymosin Beta-4): 77591-33-4 | KPV: 67727-97-3 | GHK-Cu: 49557-75-7 - **Molecular Formula**: BPC-157: C62H98N16O22 | TB-500 (Thymosin Beta-4): C212H350N56O78S | KPV: C16H29N5O4 | GHK-Cu: C14H22CuN6O4 - **Molecular Weight**: BPC-157: 1419.53 g/mol | TB-500 (Thymosin Beta-4): 4963.50 g/mol | KPV: 355.43 g/mol | GHK-Cu: 401.91 g/mol - **Amino Acid Sequence**: BPC-157 (10mg): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val | TB-500 (Thymosin Beta-4) (10mg): Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser | KPV (10mg): Lys-Pro-Val | GHK-Cu (50mg): Gly-His-Lys·Cu(II) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026KLOW80A: 99.4%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of KLOW (10MG / 10MG / 10MG / 50MG) verified?** A: Every production batch of KLOW (10MG / 10MG / 10MG / 50MG), including active Lot 2026KLOW80A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.4% peak area purity (retention time 10.88 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized KLOW?** A: Lyophilized KLOW reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of KLOW?** A: KLOW is characterized by CAS Registry identifier BPC-157: 137525-51-0 | TB-500 (Thymosin Beta-4): 77591-33-4 | KPV: 67727-97-3 | GHK-Cu: 49557-75-7, molecular formula BPC-157: C62H98N16O22 | TB-500 (Thymosin Beta-4): C212H350N56O78S | KPV: C16H29N5O4 | GHK-Cu: C14H22CuN6O4, and theoretical molecular weight BPC-157: 1419.53 g/mol | TB-500 (Thymosin Beta-4): 4963.50 g/mol | KPV: 355.43 g/mol | GHK-Cu: 401.91 g/mol. Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### Melanotan 1 (10MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/melanotan-1-10mg#product` - **Direct Product URL**: https://rhpeptides.com/product/melanotan-1-10mg/ - **SKU / MPN**: `RHP-MELANOTAN-1-10MG` / `RHP-2026MELAN10A` - **Price (USD)**: $54.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026melan10a#dataset` (https://rhpeptides.com/coa-library/2026melan10a/) - **Active Lot Number**: `2026MELAN10A` (Published: `2026-02-05`, Observed RP-HPLC Purity: `99.3%`, Retention Time: `10.18 min`, Observed Mass: `1646.85 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/Melanotan_I_10mg-01-791x1024.jpg - **Scientific Overview**: Melanotan 1 (afamelanotide) is a synthetic 13-amino-acid analog of alpha-MSH, the natural hormone that signals through melanocortin receptors in pigment cells. Two amino-acid substitutions make it more resistant to enzymatic breakdown, which a 1980 biochemistry study linked to prolonged activation of the MC1R receptor. - **In Vitro Research Application**: Typical laboratory uses: MC1R receptor-binding assays, melanin (eumelanin) synthesis pathways in melanocyte cultures, and enzymatic-stability comparisons with native alpha-MSH. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 75921-69-6 - **Molecular Formula**: C78H111N21O19 - **Molecular Weight**: 1646.85 g/mol (Da) - **Amino Acid Sequence**: Ac-Ser-Tyr-Ser-Nle-Glu-His-D-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH2 (Afamelanotide, 13 AA) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026MELAN10A: 99.3%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of Melanotan 1 (10MG) verified?** A: Every production batch of Melanotan 1 (10MG), including active Lot 2026MELAN10A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.3% peak area purity (retention time 10.18 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized Melanotan 1?** A: Lyophilized Melanotan 1 reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of Melanotan 1?** A: Melanotan 1 is characterized by CAS Registry identifier 75921-69-6, molecular formula C78H111N21O19, and theoretical molecular weight 1646.85 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### MOTS-c (10MG / 40MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/mots-c-10-mg#product` - **Direct Product URL**: https://rhpeptides.com/product/mots-c-10-mg/ - **SKU / MPN**: `RHP-MOTS-C-10-MG` / `RHP-74821` - **Price (USD)**: $69.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/74821#dataset` (https://rhpeptides.com/coa-library/74821/) - **Active Lot Number**: `74821` (Published: `2026-01-19`, Observed RP-HPLC Purity: `99.2%`, Retention Time: `9.78 min`, Observed Mass: `2174.62 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/Mots-c-Test-Report-74821-694x1024.png - **Scientific Overview**: MOTS-c is a 16-amino-acid peptide encoded in mitochondrial DNA, the genetic material of the cell's energy-producing structures. A 2015 Cell Metabolism study reported that it stimulates the AMPK energy-sensing pathway and glucose uptake in muscle cells. - **In Vitro Research Application**: Typical laboratory uses: mitochondria-to-nucleus signaling, AMPK activation, and glucose-utilization assays in metabolic cell models. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 1627580-64-6 - **Molecular Formula**: C101H152N28O22S2 - **Molecular Weight**: 2174.62 g/mol (Da) - **Amino Acid Sequence**: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg (16 AA) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 74821: 99.2%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of MOTS-c (10MG / 40MG) verified?** A: Every production batch of MOTS-c (10MG / 40MG), including active Lot 74821, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.2% peak area purity (retention time 9.78 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized MOTS-c?** A: Lyophilized MOTS-c reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of MOTS-c?** A: MOTS-c is characterized by CAS Registry identifier 1627580-64-6, molecular formula C101H152N28O22S2, and theoretical molecular weight 2174.62 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### MTP-131 (10MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/mtp-131-10mg#product` - **Direct Product URL**: https://rhpeptides.com/product/mtp-131-10mg/ - **SKU / MPN**: `RHP-MTP-131-10MG` / `RHP-2026SS3110A` - **Price (USD)**: $79.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026ss3110a#dataset` (https://rhpeptides.com/coa-library/2026ss3110a/) - **Active Lot Number**: `2026SS3110A` (Published: `2026-02-18`, Observed RP-HPLC Purity: `99.5%`, Retention Time: `7.64 min`, Observed Mass: `639.8 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026SS3110A-788x1024.jpg - **Scientific Overview**: MTP-131 (also known as SS-31 or elamipretide) is a four-amino-acid synthetic peptide designed to reach mitochondria, the cell's energy-producing structures. Published research in isolated mitochondria and respiration assays reported that it associates with cardiolipin, a lipid of the inner mitochondrial membrane. - **In Vitro Research Application**: Typical laboratory uses: cardiolipin-binding studies, mitochondrial cristae (membrane-fold) structure, and reactive-oxygen-species assays in isolated mitochondria. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 736992-21-5 - **Molecular Formula**: C32H49N9O5 - **Molecular Weight**: 639.8 g/mol (Da) - **Amino Acid Sequence**: D-Arg-2'6'-Dmt-Lys-Phe-NH2 (Elamipretide / SS-31, Tetrapeptide) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026SS3110A: 99.5%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of MTP-131 (10MG) verified?** A: Every production batch of MTP-131 (10MG), including active Lot 2026SS3110A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.5% peak area purity (retention time 7.64 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized MTP-131?** A: Lyophilized MTP-131 reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of MTP-131?** A: MTP-131 is characterized by CAS Registry identifier 736992-21-5, molecular formula C32H49N9O5, and theoretical molecular weight 639.8 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### NAD⁺ (500MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/nad-500mg#product` - **Direct Product URL**: https://rhpeptides.com/product/nad-500mg/ - **SKU / MPN**: `RHP-NAD-500MG` / `RHP-75442` - **Price (USD)**: $99.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/75442#dataset` (https://rhpeptides.com/coa-library/75442/) - **Active Lot Number**: `75442` (Published: `2026-01-22`, Observed RP-HPLC Purity: `99.6%`, Retention Time: `4.62 min`, Observed Mass: `663.43 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/NAD-1-of-2.jpg - **Scientific Overview**: NAD⁺ (nicotinamide adenine dinucleotide) is a small molecule found in every living cell. It helps cells turn nutrients into energy and is a required partner for enzymes such as sirtuins and PARPs. In the lab it is used as a substrate in enzyme assays and cell-metabolism studies. - **In Vitro Research Application**: Typical laboratory uses: sirtuin deacetylase assays, PARP DNA-repair activity assays, and studies of mitochondrial redox (energy-transfer) reactions. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 53-84-9 - **Molecular Formula**: C21H27N7O14P2 - **Molecular Weight**: 663.43 g/mol (Da) - **Amino Acid Sequence**: Nicotinamide Adenine Dinucleotide (Dinucleotide / non-peptide) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 75442: 99.6%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of NAD⁺ (500MG) verified?** A: Every production batch of NAD⁺ (500MG), including active Lot 75442, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.6% peak area purity (retention time 4.62 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized NAD⁺?** A: Lyophilized NAD⁺ reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of NAD⁺?** A: NAD⁺ is characterized by CAS Registry identifier 53-84-9, molecular formula C21H27N7O14P2, and theoretical molecular weight 663.43 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### Reconstitution Solution (3ML / 10ML) - **Product Schema `@id`**: `https://rhpeptides.com/products/bac-water#product` - **Direct Product URL**: https://rhpeptides.com/product/bac-water/ - **SKU / MPN**: `RHP-BAC-WATER` / `RHP-2138-10-2025` - **Price (USD)**: $7.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2138-10-2025#dataset` (https://rhpeptides.com/coa-library/2138-10-2025/) - **Active Lot Number**: `2138-10-2025` (Published: `2025-10-28`, Observed RP-HPLC Purity: `99.9%`, Retention Time: `3.10 min`, Observed Mass: `18.015 Da (H2O) / 108.14 Da (C7H8O)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/Endotoxin_pH-BAC-water_2138_10_2025-Water-791x1024.jpg - **Scientific Overview**: Sterile water preserved with 0.9% benzyl alcohol, supplied as a laboratory solvent for dissolving and diluting research materials. It is a solvent only and contains no peptide or other active compound. - **In Vitro Research Application**: Typical laboratory uses: reconstituting lyophilized research materials and preparing dilutions for in-vitro assays. Strictly not for human or veterinary use. For laboratory research use only. - **1:1 Analytical Properties**: - **CAS Number**: 7732-18-5 (Water) / 100-51-6 (Benzyl alcohol) - **Molecular Formula**: H2O (99.1% w/v) / C7H8O (0.9% w/v) - **Molecular Weight**: 18.015 g/mol (H2O) / 108.14 g/mol (C7H8O) - **Amino Acid Sequence**: Sterile Laboratory Solvent with 0.9% Benzyl Alcohol - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2138-10-2025: 99.9%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Sterile Aqueous Solvent in Sealed Glass Vial (Lyophilized Peptide Reconstitution Diluent) - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of Reconstitution Solution (3ML / 10ML) verified?** A: Every production batch of Reconstitution Solution (3ML / 10ML), including active Lot 2138-10-2025, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.9% peak area purity (retention time 3.10 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized Reconstitution Solution?** A: Lyophilized Reconstitution Solution reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of Reconstitution Solution?** A: Reconstitution Solution is characterized by CAS Registry identifier 7732-18-5 (Water) / 100-51-6 (Benzyl alcohol), molecular formula H2O (99.1% w/v) / C7H8O (0.9% w/v), and theoretical molecular weight 18.015 g/mol (H2O) / 108.14 g/mol (C7H8O). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### Selank (10MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/selank-10mg#product` - **Direct Product URL**: https://rhpeptides.com/product/selank-10mg/ - **SKU / MPN**: `RHP-SELANK-10MG` / `RHP-2026SELAN10A` - **Price (USD)**: $59.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026selan10a#dataset` (https://rhpeptides.com/coa-library/2026selan10a/) - **Active Lot Number**: `2026SELAN10A` (Published: `2026-03-05`, Observed RP-HPLC Purity: `99.5%`, Retention Time: `7.48 min`, Observed Mass: `751.9 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026SELAN10A-788x1024.jpg - **Scientific Overview**: Selank is a synthetic 7-amino-acid peptide based on tuftsin, a natural immune-system peptide, with a Pro-Gly-Pro tail added for stability. Published rodent studies reported that it modulates GABAergic signaling and slows the enzymatic breakdown of enkephalins. - **In Vitro Research Application**: Typical laboratory uses: GABAergic signaling assays, enkephalinase inhibition studies, and cytokine gene expression in neuro-immune cell models. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 129954-34-3 - **Molecular Formula**: C33H57N11O9 - **Molecular Weight**: 751.9 g/mol (Da) - **Amino Acid Sequence**: Thr-Lys-Pro-Arg-Pro-Gly-Pro (Tuftsin analog, 7 AA) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026SELAN10A: 99.5%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of Selank (10MG) verified?** A: Every production batch of Selank (10MG), including active Lot 2026SELAN10A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.5% peak area purity (retention time 7.48 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized Selank?** A: Lyophilized Selank reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of Selank?** A: Selank is characterized by CAS Registry identifier 129954-34-3, molecular formula C33H57N11O9, and theoretical molecular weight 751.9 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### Semax (10MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/semax-10mg#product` - **Direct Product URL**: https://rhpeptides.com/product/semax-10mg/ - **SKU / MPN**: `RHP-SEMAX-10MG` / `RHP-2026SEMAX10A` - **Price (USD)**: $59.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026semax10a#dataset` (https://rhpeptides.com/coa-library/2026semax10a/) - **Active Lot Number**: `2026SEMAX10A` (Published: `2026-02-22`, Observed RP-HPLC Purity: `99.5%`, Retention Time: `7.92 min`, Observed Mass: `813.92 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026SEMAX10A-788x1024.jpg - **Scientific Overview**: Semax is a synthetic 7-amino-acid peptide built from a fragment of ACTH (ACTH 4-10) joined to a stabilizing Pro-Gly-Pro tail. Published rat studies reported that it raises BDNF and TrkB gene expression in the hippocampus, a brain region involved in learning, without stimulating adrenal steroid production. - **In Vitro Research Application**: Typical laboratory uses: BDNF and TrkB expression in hippocampal tissue and neuronal cultures, neuroprotective signaling, and cell-survival assays under ischemic-type stress. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 80714-61-0 - **Molecular Formula**: C37H51N9O10S - **Molecular Weight**: 813.92 g/mol (Da) - **Amino Acid Sequence**: Met-Glu-His-Phe-Pro-Gly-Pro (ACTH 4-10 Pro-Gly-Pro analog, 7 AA) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026SEMAX10A: 99.5%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of Semax (10MG) verified?** A: Every production batch of Semax (10MG), including active Lot 2026SEMAX10A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.5% peak area purity (retention time 7.92 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized Semax?** A: Lyophilized Semax reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of Semax?** A: Semax is characterized by CAS Registry identifier 80714-61-0, molecular formula C37H51N9O10S, and theoretical molecular weight 813.92 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### Sermorelin (5MG / 10MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/sermorelin#product` - **Direct Product URL**: https://rhpeptides.com/product/sermorelin/ - **SKU / MPN**: `RHP-SERMORELIN` / `RHP-2026SERMO10A` - **Price (USD)**: $44.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026sermo10a#dataset` (https://rhpeptides.com/coa-library/2026sermo10a/) - **Active Lot Number**: `2026SERMO10A` (Published: `2026-02-27`, Observed RP-HPLC Purity: `99.4%`, Retention Time: `12.18 min`, Observed Mass: `3357.9 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026SERMO10A-788x1024.jpg - **Scientific Overview**: Sermorelin is a 29-amino-acid fragment (GRF 1-29) of human growth-hormone-releasing hormone. Published work reported that this fragment keeps full activity at the GHRH receptor in pituitary cell culture. - **In Vitro Research Application**: Typical laboratory uses: GHRH receptor binding, adenylate cyclase activation, and growth-hormone expression in pituitary cell models. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 86168-78-7 - **Molecular Formula**: C149H246N44O42S - **Molecular Weight**: 3357.9 g/mol (Da) - **Amino Acid Sequence**: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 (GRF 1-29 NH2, 29 AA) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026SERMO10A: 99.4%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of Sermorelin (5MG / 10MG) verified?** A: Every production batch of Sermorelin (5MG / 10MG), including active Lot 2026SERMO10A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.4% peak area purity (retention time 12.18 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized Sermorelin?** A: Lyophilized Sermorelin reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of Sermorelin?** A: Sermorelin is characterized by CAS Registry identifier 86168-78-7, molecular formula C149H246N44O42S, and theoretical molecular weight 3357.9 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### TB-500 (5MG / 10MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/tb-500#product` - **Direct Product URL**: https://rhpeptides.com/product/tb-500/ - **SKU / MPN**: `RHP-TB-500` / `RHP-2026TB5005A` - **Price (USD)**: $49.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026tb5005a#dataset` (https://rhpeptides.com/coa-library/2026tb5005a/) - **Active Lot Number**: `2026TB5005A` (Published: `2026-03-06`, Observed RP-HPLC Purity: `99.3%`, Retention Time: `11.56 min`, Observed Mass: `4963.5 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026TB5005A-788x1024.jpg - **Scientific Overview**: TB-500 is supplied as thymosin beta-4, a naturally occurring 43-amino-acid protein that binds actin, the building block of the cell's internal skeleton. Published cell-migration and actin-polymerization assays report that it sequesters free G-actin, which affects how cells move. - **In Vitro Research Application**: Typical laboratory uses: G-actin sequestration and polymerization assays, cell-migration studies, and endothelial tube-formation assays. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 77591-33-4 (Thymosin Beta-4; TB-500 fragment Ac-LKKTETQ is 889.0 g/mol, often conflated) - **Molecular Formula**: C212H350N56O78S - **Molecular Weight**: 4963.5 g/mol (Da) - **Amino Acid Sequence**: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser (Full-length Thymosin Beta-4, 43 AA) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026TB5005A: 99.3%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of TB-500 (5MG / 10MG) verified?** A: Every production batch of TB-500 (5MG / 10MG), including active Lot 2026TB5005A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.3% peak area purity (retention time 11.56 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized TB-500?** A: Lyophilized TB-500 reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of TB-500?** A: TB-500 is characterized by CAS Registry identifier 77591-33-4 (Thymosin Beta-4; TB-500 fragment Ac-LKKTETQ is 889.0 g/mol, often conflated), molecular formula C212H350N56O78S, and theoretical molecular weight 4963.5 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### TH9507 (10MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/th9507-10mg#product` - **Direct Product URL**: https://rhpeptides.com/product/th9507-10mg/ - **SKU / MPN**: `RHP-TH9507-10MG` / `RHP-75443` - **Price (USD)**: $94.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/75443#dataset` (https://rhpeptides.com/coa-library/75443/) - **Active Lot Number**: `75443` (Published: `2026-01-25`, Observed RP-HPLC Purity: `99.2%`, Retention Time: `13.45 min`, Observed Mass: `5135.9 Da (g/mol) (MW for 44-AA)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/TH9507-Janoshik-Test-Report-75443-694x1024.png - **Scientific Overview**: TH9507 is the research designation for tesamorelin, a synthetic 44-amino-acid version of growth-hormone-releasing hormone (GHRH) with a trans-hexenoyl group added to the start of the chain. Published work reported that this modification protects it from DPP-IV, an enzyme that otherwise cleaves GHRH. - **In Vitro Research Application**: Typical laboratory uses: GHRH receptor selectivity assays, DPP-IV enzyme-stability tests, and fat-cell (adipocyte) metabolism studies. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 218949-48-5 - **Molecular Formula**: C221H366N72O67S (Formula for 44-AA) - **Molecular Weight**: 5135.9 g/mol (MW for 44-AA) (Da) - **Amino Acid Sequence**: trans-hexenoyl-GRF(1-44)-NH2 (44 AA in Tesamorelin) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 75443: 99.2%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of TH9507 (10MG) verified?** A: Every production batch of TH9507 (10MG), including active Lot 75443, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.2% peak area purity (retention time 13.45 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized TH9507?** A: Lyophilized TH9507 reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of TH9507?** A: TH9507 is characterized by CAS Registry identifier 218949-48-5, molecular formula C221H366N72O67S (Formula for 44-AA), and theoretical molecular weight 5135.9 g/mol (MW for 44-AA) (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### TH9507 / Ipamorelin Blend (6MG / 2MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/th9507-ipamorelin-blend-8mg-6mg-2mg#product` - **Direct Product URL**: https://rhpeptides.com/product/th9507-ipamorelin-blend-8mg-6mg-2mg/ - **SKU / MPN**: `RHP-TH9507-IPAMORELIN-BLEND-8MG-6MG-2MG` / `RHP-2026TESAIPA62A` - **Price (USD)**: $94.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026tesaipa62a#dataset` (https://rhpeptides.com/coa-library/2026tesaipa62a/) - **Active Lot Number**: `2026TESAIPA62A` (Published: `2026-03-02`, Observed RP-HPLC Purity: `99.3%`, Retention Time: `13.10 min`, Observed Mass: `TH9507 (Tesamorelin): 5135.90 Da | Ipamorelin: 711.86 Da`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026TESAIPA62A-788x1024.jpg - **Scientific Overview**: A two-peptide research blend of TH9507 (tesamorelin, a GHRH analog) and Ipamorelin. The two act on different pituitary receptors: TH9507 on the GHRH receptor and Ipamorelin on the ghrelin receptor (GHS-R1a). Published cell-culture work has studied each in endocrine cells. Each component is listed separately below. - **In Vitro Research Application**: Typical laboratory uses: studying how endocrine cell cultures respond when the GHRH receptor and the ghrelin receptor are engaged together. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: TH9507 (Tesamorelin): 218949-48-5 | Ipamorelin: 170851-70-4 - **Molecular Formula**: TH9507 (Tesamorelin): C221H366N72O67S | Ipamorelin: C38H49N9O5 - **Molecular Weight**: TH9507 (Tesamorelin): 5135.90 g/mol | Ipamorelin: 711.86 g/mol - **Amino Acid Sequence**: TH9507 (Tesamorelin) (6mg / 8mg): trans-hexenoyl-GRF(1-44)-NH2 | Ipamorelin (2mg): Aib-His-D-2Nal-D-Phe-Lys-NH2 - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026TESAIPA62A: 99.3%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of TH9507 / Ipamorelin Blend (6MG / 2MG) verified?** A: Every production batch of TH9507 / Ipamorelin Blend (6MG / 2MG), including active Lot 2026TESAIPA62A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.3% peak area purity (retention time 13.10 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized TH9507 / Ipamorelin Blend?** A: Lyophilized TH9507 / Ipamorelin Blend reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of TH9507 / Ipamorelin Blend?** A: TH9507 / Ipamorelin Blend is characterized by CAS Registry identifier TH9507 (Tesamorelin): 218949-48-5 | Ipamorelin: 170851-70-4, molecular formula TH9507 (Tesamorelin): C221H366N72O67S | Ipamorelin: C38H49N9O5, and theoretical molecular weight TH9507 (Tesamorelin): 5135.90 g/mol | Ipamorelin: 711.86 g/mol. Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### Thymosin Alpha-1 (10MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/thymosin-alpha-1-10mg#product` - **Direct Product URL**: https://rhpeptides.com/product/thymosin-alpha-1-10mg/ - **SKU / MPN**: `RHP-THYMOSIN-ALPHA-1-10MG` / `RHP-2026THYMO10A` - **Price (USD)**: $79.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026thymo10a#dataset` (https://rhpeptides.com/coa-library/2026thymo10a/) - **Active Lot Number**: `2026THYMO10A` (Published: `2026-02-24`, Observed RP-HPLC Purity: `99.4%`, Retention Time: `11.12 min`, Observed Mass: `3108.3 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/2026THYMO10A-788x1024.jpg - **Scientific Overview**: Thymosin Alpha-1 is a 28-amino-acid peptide originally isolated from thymus tissue. Published research in mouse dendritic cells and human lymphocytes has examined its activation of Toll-like receptor 9 (TLR9) signaling and its influence on T-cell maturation. - **In Vitro Research Application**: Typical laboratory uses: TLR9/MyD88 signaling in dendritic cells, T-cell differentiation assays, and cytokine-response studies in immune-cell cultures. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 62304-98-7 - **Molecular Formula**: C129H215N33O55 - **Molecular Weight**: 3108.3 g/mol (Da) - **Amino Acid Sequence**: Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH (28 AA) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026THYMO10A: 99.4%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of Thymosin Alpha-1 (10MG) verified?** A: Every production batch of Thymosin Alpha-1 (10MG), including active Lot 2026THYMO10A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.4% peak area purity (retention time 11.12 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized Thymosin Alpha-1?** A: Lyophilized Thymosin Alpha-1 reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of Thymosin Alpha-1?** A: Thymosin Alpha-1 is characterized by CAS Registry identifier 62304-98-7, molecular formula C129H215N33O55, and theoretical molecular weight 3108.3 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. ### VIP (10MG) - **Product Schema `@id`**: `https://rhpeptides.com/products/vip-10mg#product` - **Direct Product URL**: https://rhpeptides.com/product/vip-10mg/ - **SKU / MPN**: `RHP-VIP-10MG` / `RHP-2026VIP10A` - **Price (USD)**: $59.95 (InStock) - **Active COA Dataset `@id`**: `https://rhpeptides.com/coa-library/2026vip10a#dataset` (https://rhpeptides.com/coa-library/2026vip10a/) - **Active Lot Number**: `2026VIP10A` (Published: `2026-02-08`, Observed RP-HPLC Purity: `99.1%`, Retention Time: `12.30 min`, Observed Mass: `3325.8 Da (g/mol)`) - **COA Chromatogram File**: https://rhpeptides.com/wp-content/themes/rh-peptides-theme/assets/img/coas/VIP-1-of-2.jpg - **Scientific Overview**: VIP (vasoactive intestinal peptide) is a naturally occurring 28-amino-acid neuropeptide first described in 1970. It signals through two receptors, VPAC1 and VPAC2, which raise the second messenger cAMP inside cells. In the lab it is used to study receptor binding and anti-inflammatory signaling in cell models. - **In Vitro Research Application**: Typical laboratory uses: VPAC1/VPAC2 receptor binding, adenylate cyclase and cAMP activation, and cellular anti-inflammatory signaling assays. For in-vitro laboratory research only. Not for human or animal use. - **1:1 Analytical Properties**: - **CAS Number**: 40077-57-4 - **Molecular Formula**: C147H238N44O42S - **Molecular Weight**: 3325.8 g/mol (Da) - **Amino Acid Sequence**: His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 (28 AA) - **Chromatographic Purity (RP-HPLC)**: >=99.0% Peak Area (Observed Lot 2026VIP10A: 99.1%) - **Identity Verification**: Electrospray Ionization Mass Spectrometry (ESI-MS) - **Physical Form**: Lyophilized Powder in Sealed Desiccated Glass Vial - **Recommended Storage**: -20°C Desiccated & Protected from Light - **Regulatory Classification**: Research Use Only (RUO) — Not a 503A Compounding Pharmacy Product; Strictly Not for Human or Veterinary Use - **Compound Technical FAQs**: - **Q: How is the chromatographic purity of VIP (10MG) verified?** A: Every production batch of VIP (10MG), including active Lot 2026VIP10A, undergoes independent Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) with UV/Vis detection at 214 nm and Electrospray Ionization Mass Spectrometry (ESI-MS), confirming 99.1% peak area purity (retention time 12.30 min) and exact molecular mass concordance prior to catalog release. - **Q: What are the laboratory storage and stability parameters for lyophilized VIP?** A: Lyophilized VIP reference material is supplied in a sealed, desiccated borosilicate glass vial under inert atmosphere and must be stored at -20°C protected from light to prevent hydrolytic or oxidative cleavage. Once solubilized in sterile aqueous buffer for in vitro assays, maintain aliquots at 2°C to 8°C and avoid repeated freeze-thaw cycles. - **Q: What are the chemical identifiers and regulatory classification of VIP?** A: VIP is characterized by CAS Registry identifier 40077-57-4, molecular formula C147H238N44O42S, and theoretical molecular weight 3325.8 g/mol (Da). Regenerative Health Peptides supplies this reagent strictly as a Research Use Only (RUO) analytical reference material for qualified 21+ in vitro laboratory investigations, never for human or veterinary use. --- ## 3. Analytical Testing Methodologies (RP-HPLC & ESI-MS) ### 3.1 Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) Every production batch supplied by Regenerative Health Peptides is assayed via Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) utilizing an octadecylsilane (C18) stationary phase column with a binary mobile-phase gradient of ultrapure water (0.1% trifluoroacetic acid) and acetonitrile (0.1% trifluoroacetic acid). Ultraviolet (UV) absorbance is monitored at 214 nm, corresponding to the pi-to-pi* electronic transition of the peptide amide backbone. Peak area integration quantifies the target peptide peak relative to any truncation sequences, deletion by-products, or oxidative impurities, enforcing a strict release benchmark of >=99.0% chromatographic purity. ### 3.2 Electrospray Ionization Mass Spectrometry (ESI-MS) While RP-HPLC establishes chromatographic homogeneity, molecular identity is independently verified via Electrospray Ionization Mass Spectrometry (ESI-MS). The ionized peptide sample generates a characteristic envelope of multiply charged molecular ions (`[M+H]+`, `[M+2H]2+`, `[M+3H]3+`, `[M+4H]4+`). Spectral deconvolution confirms that the observed molecular mass (in Daltons, Da) matches the theoretical monoisotopic and average molecular weight calculated from the empirical chemical formula within +/- 0.1% mass tolerance. ### 3.3 Lyophilization, Storage Stability & In Vitro Reconstitution Compounds are lyophilized (freeze-dried) under vacuum and sealed in desiccated Type I borosilicate glass vials to prevent hydrolytic cleavage of labile amide bonds and oxidation of methionine, cysteine, or tryptophan residues. Unreconstituted vials must be stored at -20°C protected from light. For in vitro cellular and biochemical assays, researchers equilibrate vials to ambient room temperature inside a desiccator before gentle reconstitution with sterile aqueous solvent oriented along the interior glass wall, avoiding mechanical vortexing. --- ## 4. Verbatim Global Laboratory & Compliance FAQs ### Q1: What does Research Use Only (RUO) classification signify for laboratory reagents? Research Use Only (RUO) designates biochemical reference materials supplied exclusively for in vitro laboratory experimentation, analytical chromatography calibration, and cellular signaling studies by qualified professionals aged 21 and older. Regenerative Health Peptides is a dedicated chemical supplier, not a 503A or 503B compounding pharmacy; all compounds are strictly prohibited from human or veterinary use. ### Q2: How are research peptides assayed for chromatographic purity and molecular identity? Every production lot undergoes dual-stage analytical characterization via Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) using C18 stationary columns and UV detection at 214 nm to confirm >=99.0% peak area purity. Identity verification is conducted concurrently via Electrospray Ionization Mass Spectrometry (ESI-MS) to validate observed molecular mass (Da) against theoretical monoisotopic calculations. ### Q3: Where can researchers inspect lot-specific Certificates of Analysis (COAs)? Lot-specific Certificates of Analysis (COAs) containing full RP-HPLC chromatographic traces, peak integration tables, retention times, and ESI-MS mass spectra are published directly on each compound product page and indexed in the public COA Library at rhpeptides.com/coa-library. Every physical vial displays a traceable lot identifier matching its archived analytical dataset. ### Q4: How are lyophilized peptide reference materials packaged for transit stability? All peptide reagents are supplied as unformulated lyophilized powder cakes sealed inside Type I borosilicate glass vials with butyl rubber stoppers and crimped aluminum flip-off seals. Lyophilization removes residual bound water to prevent hydrolytic degradation during ambient domestic courier transit, preserving structural sequence integrity until laboratory freezer storage. ### Q5: What are the recommended laboratory storage parameters for lyophilized peptides? Unreconstituted lyophilized peptide vials should be stored immediately upon receipt at -20°C in a desiccated, light-protected laboratory freezer to maintain long-term structural stability for up to 24 months. Following solubilization in sterile aqueous laboratory solvent for in vitro cellular assays, working aliquots should be refrigerated at 2°C to 8°C. ### Q6: Does Regenerative Health Peptides provide clinical or biological administration guidance? No. Because all catalog items are strictly Research Use Only (RUO) chemical reagents intended exclusively for in vitro laboratory assays, Regenerative Health Peptides strictly prohibits and refuses any inquiry regarding biological administration, clinical protocols, or non-laboratory handling. Any communication implying non-research application results in immediate order cancellation and permanent account termination. ### Q7: What are the laboratory dispatch cutoff times and domestic shipping policies? Verified research orders submitted prior to 2:00 PM PST (14:00:00-08:00) on business days qualify for same-day laboratory dispatch from our United States fulfillment facility via tracked expedited courier. Orders exceeding $300 USD automatically receive complimentary domestic standard shipping, with protective insulated packaging utilized to safeguard reagent integrity during transit. ### Q8: Are institutional bulk quantities and multi-lot analytical reservations available? Yes. Regenerative Health Peptides supports accredited universities, contract research organizations (CROs), and biotechnology laboratories with tiered volume pricing and single-lot batch reservations to eliminate inter-batch variance across longitudinal in vitro studies. Qualified principal investigators and procurement officers may contact support@rhpeptides.com to coordinate custom analytical supply agreements. ### Q9: Which payment instruments are supported for laboratory procurement? Our encrypted laboratory checkout supports major commercial and institutional credit cards, automated clearing house (ACH) eCheck bank transfers, institutional wire settlements, and direct cryptocurrency clearing. All transactions undergo automated researcher eligibility verification and mandatory Research Use Only (RUO) compliance attestation prior to fulfillment release. --- ## 5. Mandatory Research Use Only (RUO) & Non-503A Compliance Notice Research Use Only (RUO): All compounds supplied by Regenerative Health Peptides are intended strictly for in vitro laboratory research and analytical testing by qualified professionals aged 21+. Not for human or veterinary use, ingestion, or diagnostic/therapeutic application. Regenerative Health Peptides is a chemical supplier and is not a 503A or 503B compounding pharmacy.